Antibodies

Jump to Filters
View as table Download
VDAC2 Rabbit Polyclonal Antibody
TA338534

USD 375.00

5 Days

Rabbit Polyclonal Anti-VDAC2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV
VDAC2 Rabbit Polyclonal Antibody
TA324028

USD 345.00

4 Weeks

Anti-VDAC2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 283-294 amino acids of human voltage-dependent anion channel 2