Antibodies

Jump to Filters
View as table Download
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA345768

USD 410.00

5 Days

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA590463

USD 409.00

In Stock

Rabbit Polyclonal Placental Lactogen Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Placental lactogen (CSH1) (C-term) Rabbit Polyclonal Antibody
AP51099PU-N

USD 450.00

2 Weeks

Placental lactogen (CSH1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 180-208 amino acids from the C-terminal region of human CSH1
Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
CF506708

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA327692

USD 380.00

5 Days

Rabbit Polyclonal hPL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Placental lactogen (CSH1) Rabbit Polyclonal Antibody
TA350056

USD 345.00

In Stock

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CSH1
Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
TA506708

USD 379.00

In Stock

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Placental lactogen (CSH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G4]
TA506708AM

USD 420.00

4 Weeks

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin
Placental lactogen (CSH1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G4]
TA506708BM

USD 420.00

4 Weeks

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP
Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: OTI2G4]
TA506708S

USD 159.00

2 Days

CSH1 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Placental lactogen (CSH1) Mouse Monoclonal Antibody [Clone ID: OTI1C9]
TA506814S

USD 159.00

2 Days

CSH1 mouse monoclonal antibody,clone OTI1C9

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".