Antibodies

Jump to Filters
View as table Download
CYBB Rabbit Polyclonal Antibody
TA349081

USD 484.00

5 Days

Rabbit Polyclonal Anti-NOX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2.
CYBB Goat Polyclonal Antibody
TA305618

USD 375.00

In Stock

Goat Anti-CYBB / GP91-PHOX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SYLNFARKRIKNP, from the internal region of the protein sequence according to NP_000388.2.
CYBB Rabbit Polyclonal Antibody
TA335229

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYBB Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
CYBB (151-163) Goat Polyclonal Antibody
AP23109PU-N

USD 440.00

2 Weeks

CYBB (151-163) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CYBB / gp91phox (NP_000388.2)
CYBB Rabbit Polyclonal Antibody
TA351456

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYBB Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBB