Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 18 of 18 results

(reset)

SHMT2 Rabbit Polyclonal Antibody

TA327002

USD 380.00

3 Weeks

Rabbit anti-SHMT2 Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human SHMT2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

SHMT2 Rabbit Polyclonal Antibody

TA339281

USD 310.00

5 Days

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

1 / 2

2 / 2

Previous Next

SHMT2 Rabbit Polyclonal Antibody

TA339282

USD 375.00

5 Days

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

1 / 2

2 / 2

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

CF808813

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

CF808814

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

CF808820

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

TA808813

USD 379.00

In Stock

SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]

TA808813AM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E12, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]

TA808813BM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E12, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

TA808813S

USD 159.00

2 Days

SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

TA808814

USD 379.00

In Stock

SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]

TA808814AM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E6, Biotinylated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E6]

TA808814BM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody,clone OTI1E6, HRP conjugated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

TA808814S

USD 159.00

2 Days

SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

TA808820

USD 379.00

In Stock

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SHMT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E9]

TA808820AM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SHMT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E9]

TA808820BM

USD 420.00

4 Weeks

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

TA808820S

USD 159.00

2 Days

SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 18 of 18 results