Antibodies

Jump to Filters
View as table Download
ALG11 Rabbit Polyclonal Antibody
TA335312

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALG11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG11 antibody: synthetic peptide directed towards the C terminal of human ALG11. Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES
ALG11 Rabbit Polyclonal Antibody
TA350849

USD 345.00

In Stock

Rabbit Polyclonal Anti-ALG11 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALG11