Antibodies

Jump to Filters
View as table Download
SH3BP2 Rabbit Polyclonal Antibody
TA342205

USD 375.00

5 Days

Rabbit polyclonal Anti-SH3BP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3BP2 antibody: synthetic peptide directed towards the middle region of human SH3BP2. Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ