Rabbit Polyclonal Anti-SSTR1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSTR1 antibody: synthetic peptide directed towards the C terminal of human SSTR1. Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD |
Rabbit Polyclonal Anti-SSTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SSTR1 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human SSTR1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Sheep, Bovine, Bat, Dog, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Turkey, Chicken (87%); Zebrafish (80%). |
Rabbit Polyclonal Anti-SSTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SSTR1 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human SSTR1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Sheep, Goat, Bovine, Bat, Horse, Rabbit, Pig (100%); Hamster, Elephant (95%). |
Anti-SSTR1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 370-384 amino acids of human somatostatin receptor 1 |
Germany
Japan
United Kingdom
China
