Antibodies

Jump to Filters
View as table Download
CDC20 Rabbit Polyclonal Antibody
TA330362

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDC20 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC20 antibody: synthetic peptide directed towards the N terminal of human CDC20. Synthetic peptide located within the following region: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSH
CDC20 Rabbit Polyclonal Antibody
TA321317

USD 345.00

In Stock

Anti-CDC20 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog
CDC20 Rabbit Polyclonal Antibody
TA321318

USD 345.00

In Stock

Anti-CDC20 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog