Antibodies

Jump to Filters
View as table Download
VMAT1 (SLC18A1) Rabbit Polyclonal Antibody
TA339065

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC18A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC18A1 antibody: synthetic peptide directed towards the middle region of human SLC18A1. Synthetic peptide located within the following region: YYLRSPPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
VMAT1 (SLC18A1) Rabbit Polyclonal Antibody
TA323893

USD 345.00

4 Weeks

Anti-SLC18A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 104-117 amino acids of human solute carrier family 18 (vesicular monoamine), member 1