Antibodies

Jump to Filters
View as table Download
FGF2 Rabbit Polyclonal Antibody
TA346315

USD 475.00

5 Days

Rabbit Polyclonal Anti-FGF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
FGF2 Rabbit Polyclonal Antibody
AP23263PU-N

USD 405.00

2 Weeks

FGF2 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A peptide mapping near the N-terminal of Human FGF2, identical to the related Rat and Mouse sequence
FGF2 Rabbit Polyclonal Antibody
TA328311

USD 285.00

5 Days

Anti-Human FGF-basic Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human FGF-basic (154 a.a.)
FGF2 (Center) Rabbit Polyclonal Antibody
AP51656PU-N

USD 450.00

2 Weeks

FGF2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 37-66 amino acids from the Central region of human FGF2
FGF2 Mouse Monoclonal Antibody [Clone ID: OTI3D9]
CF500012

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) BFGF mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FGF2 Rabbit Polyclonal Antibody
TA321420

USD 345.00

4 Weeks

Anti-FGF2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 215-229 amino acids of Human Fibroblast growth factor 2
FGF2 Mouse Monoclonal Antibody [Clone ID: OTI3D9]
TA500012

USD 379.00

In Stock

bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
FGF2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D9]
TA500012BM

USD 420.00

4 Weeks

bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
FGF2 Mouse Monoclonal Antibody [Clone ID: OTI3D9]
TA500012S

USD 159.00

In Stock

bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".