Antibodies

View as table Download

NUDT9 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 317-347 amino acids from the C-terminal region of Human NUDT9

Rabbit Polyclonal Anti-NUDT9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the C terminal of human NUDT9. Synthetic peptide located within the following region: LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHA

Carrier-free (BSA/glycerol-free) NUDT9 mouse monoclonal antibody, clone OTI7A12 (formerly 7A12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NUDT9 mouse monoclonal antibody, clone OTI7A12 (formerly 7A12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NUDT9 mouse monoclonal antibody, clone OTI7A12 (formerly 7A12), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

NUDT9 mouse monoclonal antibody, clone OTI7A12 (formerly 7A12), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

NUDT9 mouse monoclonal antibody, clone OTI7A12 (formerly 7A12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".