Antibodies

Jump to Filters
View as table Download
RRP4 (EXOSC2) Rabbit Polyclonal Antibody
TA343807

USD 410.00

5 Days

Rabbit Polyclonal Anti-EXOSC2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the N terminal of human EXOSC2. Synthetic peptide located within the following region: RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV