Antibodies

Jump to Filters
View as table Download
GGPS1 Rabbit Polyclonal Antibody
TA346695

USD 475.00

5 Days

Rabbit Polyclonal Anti-GGPS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the middle region of human GGPS1. Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ
GGPS1 Mouse Monoclonal Antibody [Clone ID: OTI3F9]
CF501731

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GGPS1 Mouse Monoclonal Antibody [Clone ID: OTI3F9]
TA501731

USD 379.00

In Stock

GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GGPS1 Mouse Monoclonal Antibody [Clone ID: OTI3F9]
TA501731S

USD 159.00

2 Days

GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".