Antibodies

Jump to Filters
View as table Download
EPB4IL2 (EPB41L2) (347-357) Goat Polyclonal Antibody
AP23060PU-N

USD 440.00

2 Weeks

EPB4IL2 (EPB41L2) (347-357) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Synthetic peptide from an internal region of human EPB41L2
EPB4IL2 (EPB41L2) Rabbit Polyclonal Antibody
TA335005

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPB41L2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPB41L2 antibody: synthetic peptide directed towards the middle region of human EPB41L2. Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST