Antibodies

Jump to Filters
View as table Download
UBE1C (UBA3) Rabbit Polyclonal Antibody
TA339680

USD 375.00

5 Days

Rabbit Polyclonal Anti-UBA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBA3 antibody: synthetic peptide directed towards the N terminal of human UBA3. Synthetic peptide located within the following region: EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCEL
UBE1C (UBA3) Mouse Monoclonal Antibody [Clone ID: OTI7H6]
CF811903

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) UBA3 mouse monoclonal antibody,clone OTI7H6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
UBE1C (UBA3) Mouse Monoclonal Antibody [Clone ID: OTI7H6]
TA811903

USD 379.00

In Stock

UBA3 mouse monoclonal antibody,clone OTI7H6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
UBE1C (UBA3) Mouse Monoclonal Antibody [Clone ID: OTI7H6]
TA811903S

USD 159.00

2 Days

UBA3 mouse monoclonal antibody,clone OTI7H6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".