Antibodies

Jump to Filters
View as table Download
ACAA1 Rabbit Polyclonal Antibody
TA346554

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACAA1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD
ACAA1 Mouse Monoclonal Antibody [Clone ID: OTI4F1]
CF811054

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ACAA1 Mouse Monoclonal Antibody [Clone ID: OTI4F1]
TA811054

USD 379.00

In Stock

ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ACAA1 Mouse Monoclonal Antibody [Clone ID: OTI4F1]
TA811054S

USD 159.00

2 Days

ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".