Antibodies

Jump to Filters
View as table Download
CD299 (CLEC4M) Rabbit Polyclonal Antibody
TA346481

USD 410.00

5 Days

Rabbit Polyclonal Anti-CLEC4M Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the N terminal of human CLEC4M. Synthetic peptide located within the following region: LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV
CD299 (CLEC4M) Mouse Monoclonal Antibody [Clone ID: OTI10C3]
CF810055

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CLEC4M mouse monoclonal antibody,clone OTI10C3

Applications IHC
Reactivities Human
Conjugation Unconjugated
CD299 (CLEC4M) Mouse Monoclonal Antibody [Clone ID: OTI7D12]
CF810067

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CLEC4M mouse monoclonal antibody,clone OTI7D12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
CLEC4M Rabbit Polyclonal Antibody
TA367492

USD 380.00

4 Weeks

CLEC4M rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLEC4M
CD299 (CLEC4M) Mouse Monoclonal Antibody [Clone ID: 160000000]
TA385701

USD 523.00

2 Weeks

Recombinant Anti-DC-SIGNR (Clone 16E7)

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated
CD299 (CLEC4M) Rabbit Monoclonal Antibody [Clone ID: 160000000]
TA385702

USD 523.00

5 Weeks

Recombinant Anti-DC-SIGNR (Clone 16E7)

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques.
CD299 (CLEC4M) Mouse Monoclonal Antibody [Clone ID: OTI10C3]
TA810055

USD 379.00

In Stock

CLEC4M mouse monoclonal antibody,clone OTI10C3

Applications IHC
Reactivities Human
Conjugation Unconjugated