Antibodies

Jump to Filters
View as table Download
CYP11A1 Rabbit Polyclonal Antibody
TA339994

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP11A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11A1 antibody: synthetic peptide directed towards the middle region of human CYP11A1. Synthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW
CYP11A1 Rabbit Polyclonal Antibody
TA349851

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYP11A1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP11A1
CYP11A1 Rabbit Polyclonal Antibody
TA375269

USD 220.00

3 Weeks

CYP11A1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-320 of human CYP11A1 (NP_000772.2).
Modifications Unmodified