Antibodies

Jump to Filters
View as table Download
beta glucuronidase (GUSB) (Center) Rabbit Polyclonal Antibody
AP51986PU-N

USD 450.00

2 Weeks

beta glucuronidase (GUSB) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Porcine
Immunogen KLH conjugated synthetic peptide between 335 - 362 amino acids from the Center region of Human Beta-glucuronidase
beta glucuronidase (GUSB) (C-term) Rabbit Polyclonal Antibody
AP51987PU-N

USD 450.00

2 Weeks

beta glucuronidase (GUSB) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 514-544 amino acids from the C-terminal region of Human Beta-glucuronidase
beta glucuronidase (GUSB) Rabbit Polyclonal Antibody
TA334656

USD 310.00

5 Days

Rabbit Polyclonal Anti-GUSB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF
GUSB Rabbit Polyclonal Antibody
TA366324

USD 380.00

4 Weeks

GUSB rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GUSB
GUSB Rabbit Polyclonal Antibody
TA370672

USD 380.00

4 Weeks

GUSB rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GUSB