Antibodies

Jump to Filters
View as table Download
POGZ Rabbit Polyclonal Antibody
TA343769

USD 410.00

5 Days

Rabbit Polyclonal Anti-POGZ Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POGZ antibody: synthetic peptide directed towards the N terminal of human POGZ. Synthetic peptide located within the following region: EELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHASVA