Antibodies

Jump to Filters
View as table Download
CBX6 Rabbit Polyclonal Antibody
TA343728

USD 410.00

5 Days

Rabbit Polyclonal Anti-CBX6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CBX6 antibody: synthetic peptide directed towards the N terminal of human CBX6. Synthetic peptide located within the following region: FAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQK
CBX6 Rabbit Polyclonal Antibody
TA374329

USD 220.00

3 Weeks

CBX6 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human CBX6 (NP_055107.3).
Modifications Unmodified