Antibodies

Jump to Filters
View as table Download
NOL5A (NOP56) Rabbit Polyclonal Antibody
TA345960

USD 475.00

5 Days

Rabbit Polyclonal Anti-NOL5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NOL5A antibody: synthetic peptide directed towards the middle region of human NOL5A. Synthetic peptide located within the following region: YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK
NOP56 Rabbit Polyclonal Antibody
TA384879

USD 380.00

4 Weeks

NOP56 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthesized peptide derived from NOP56 at AA range: 191-240