Antibodies

Jump to Filters
View as table Download
PHF1 Rabbit Polyclonal Antibody
TA331748

USD 310.00

5 Days

Rabbit Polyclonal Anti-PHF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PHF1 Antibody: synthetic peptide directed towards the C terminal of human PHF1. Synthetic peptide located within the following region: PSPNQSYQGSSGYNFRPTDARCLPSSPIRMFASFHPSASTAGTSGDSGPP
PHF1 Rabbit Polyclonal Antibody
TA379864

USD 220.00

3 Weeks

PHF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human PHF1 (NP_077084.1).
Modifications Unmodified