Antibodies

Jump to Filters
View as table Download
SUPT5H Rabbit Polyclonal Antibody
TA334033

USD 375.00

5 Days

Rabbit Polyclonal Anti-SUPT5H Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SUPT5H Antibody: synthetic peptide directed towards the C terminal of human SUPT5H. Synthetic peptide located within the following region: PYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQA