Antibodies

View as table Download

Goat Polyclonal Anti-PDIA2 (aa477-481) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDIA2 (aa477-481) Antibody: Peptide with sequence C-EYKSTRDLETFSK, from the internal region (near C Terminus) of the protein sequence according to NP_006840.2.

Rabbit Polyclonal Anti-NDRG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NDRG2 antibody: synthetic peptide directed towards the C terminal of human NDRG2. Synthetic peptide located within the following region: GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG

Anti-NDRG2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-39 amino acids of Human NDRG family member 2

Anti-NDRG2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 25-39 amino acids of Human NDRG family member 2