Antibodies

Jump to Filters
View as table Download
POU4F3 Rabbit Polyclonal Antibody
TA332118

USD 310.00

5 Days

Rabbit Polyclonal Anti-POU4F3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-POU4F3 Antibody: synthetic peptide directed towards the middle region of human POU4F3. Synthetic peptide located within the following region: ALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYR