Antibodies

View as table Download

Rabbit Polyclonal Anti-CHRND Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA

CHRND rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHRND