Antibodies

Jump to Filters
View as table Download
CYBB Rabbit Polyclonal Antibody
TA349081

USD 484.00

5 Days

Rabbit Polyclonal Anti-NOX2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal NOX2 antibody was raised against a 15 amino acid peptide near the amino terminus of human NOX2.
CYBB Goat Polyclonal Antibody
TA305618

USD 375.00

In Stock

Goat Anti-CYBB / GP91-PHOX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SYLNFARKRIKNP, from the internal region of the protein sequence according to NP_000388.2.
CYBB Rabbit Polyclonal Antibody
TA335229

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYBB Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
CYBB (151-163) Goat Polyclonal Antibody
AP23109PU-N

USD 440.00

2 Weeks

CYBB (151-163) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CYBB / gp91phox (NP_000388.2)
CYBB Rabbit Polyclonal Antibody
TA351456

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYBB Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBB
CYBB Rabbit Polyclonal Antibody
TA367159

USD 380.00

4 Weeks

CYBB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYBB
CYBB Rabbit Polyclonal Antibody
TA384074

USD 380.00

4 Weeks

NOX2 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human CYBB. AA range:111-160