Antibodies

Jump to Filters
View as table Download
CYP21A2 Rabbit Polyclonal Antibody
TA342859

USD 375.00

5 Days

Rabbit Polyclonal Anti-CYP21A2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP21A2 antibody: synthetic peptide directed towards the C terminal of human CYP21A2. Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA
CYP21A2 Rabbit Polyclonal Antibody
TA349853

USD 345.00

In Stock

Rabbit Polyclonal Anti-CYP21A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP21A2
CYP21A2 Rabbit Polyclonal Antibody
TA364742

USD 380.00

4 Weeks

CYP21A2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP21A2