Rabbit Polyclonal Anti-NMDA Receptor 2A (GluN2A) (extracellular)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide GHSHDVTERELRN(C), corresponding to amino acid residues 41-53 of rat NMDA Receptor 2A . Extracellular, N-terminus. |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GRIN2A |
GRIN2A rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GRIN2A |
NMDAR2A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human NMDAR2A (NP_000824.1). |
| Modifications | Unmodified |
Phospho-NMDAR2A/2B (Tyr1246/Tyr1252) Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human NMDAR2A/B around the phosphorylation site of Tyr1246/1252. AA range:1216-1265 (Phosphorylated) |
Germany
Japan
United Kingdom
China
