Antibodies

Jump to Filters
View as table Download
HYAL1 Rabbit Polyclonal Antibody
TA339811

USD 375.00

5 Days

Rabbit Polyclonal Anti-HYAL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1. Synthetic peptide located within the following region: WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYY
HYAL1 Rabbit Polyclonal Antibody
TA377295

USD 220.00

3 Weeks

HYAL1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 136-435 of human HYAL1 (NP_149349.2).
Modifications Unmodified