Antibodies

Jump to Filters
View as table Download
C19orf28 (MFSD12) Rabbit Polyclonal Antibody
TA335949

USD 375.00

5 Days

Rabbit Polyclonal Anti-C19orf28 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C19orf28 Antibody: synthetic peptide directed towards the middle region of human C19orf28. Synthetic peptide located within the following region: VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD