Antibodies

Jump to Filters
View as table Download
PGRMC1 Rabbit Polyclonal Antibody
TA341853

USD 375.00

5 Days

Rabbit Polyclonal Anti-PGRMC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGRMC1 antibody: synthetic peptide directed towards the N terminal of human PGRMC1. Synthetic peptide located within the following region: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
PGRMC1 Rabbit Polyclonal Antibody
TA369269

USD 380.00

4 Weeks

PGRMC1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PGRMC1