Antibodies

Jump to Filters
View as table Download
Cyclophilin A (PPIA) Rabbit Polyclonal Antibody
TA339204

USD 310.00

5 Days

Rabbit Polyclonal Anti-PPIA

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPIA antibody: synthetic peptide directed towards the middle region of human PPIA. Synthetic peptide located within the following region: TAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Cyclophilin A (PPIA) Rabbit Polyclonal Antibody
TA350296

USD 345.00

In Stock

Rabbit Polyclonal Anti-PPIA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPIA