Antibodies

Jump to Filters
View as table Download
RPS16 Rabbit Polyclonal Antibody
TA334137

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-RPS16 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the N terminal of human RPS16. Synthetic peptide located within the following region: SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL
RPS16 Rabbit Polyclonal Antibody
TA366369

USD 380.00

4 Weeks

RPS16 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPS16
RPS16 Rabbit Polyclonal Antibody
TA370716

USD 380.00

4 Weeks

RPS16 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPS16