Antibodies

Jump to Filters
View as table Download
Viperin (RSAD2) Rabbit Polyclonal Antibody
TA329507

USD 310.00

5 Days

Rabbit Polyclonal anti-RSAD2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RSAD2 antibody: synthetic peptide directed towards the C terminal of human RSAD2. Synthetic peptide located within the following region: YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY