Antibodies

Jump to Filters
View as table Download
Semenogelin I (SEMG1) Rabbit Polyclonal Antibody
TA346337

USD 410.00

5 Days

Rabbit Polyclonal Anti-SEMG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMG1 antibody: synthetic peptide directed towards the N terminal of human SEMG1. Synthetic peptide located within the following region: QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL
Semenogelin I (SEMG1) Rabbit Polyclonal Antibody
TA332720

USD 275.00

3 Weeks

Rabbit anti-SEMG1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SEMG1