Antibodies

Jump to Filters
View as table Download
SIM1 (N-term) Rabbit Polyclonal Antibody
AP53918PU-N

USD 450.00

2 Weeks

SIM1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SIM1
SIM1 Rabbit Polyclonal Antibody
TA333953

USD 375.00

5 Days

Rabbit Polyclonal Anti-SIM1 Antibody

Applications IHC
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIM1 Antibody is: synthetic peptide directed towards the middle region of Human SIM1. Synthetic peptide located within the following region: SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR
SIM1 Rabbit Polyclonal Antibody
TA355991

USD 360.00

5 Days

SIM1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SIM1