Antibodies

Jump to Filters
View as table Download
TARS1 Rabbit Polyclonal Antibody
TA339373

USD 310.00

5 Days

Rabbit Polyclonal Anti-TARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARS antibody: synthetic peptide directed towards the N terminal of human TARS. Synthetic peptide located within the following region: PEYIYTRLEMYNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKT
TARS1 Rabbit Polyclonal Antibody
TA382310

USD 220.00

3 Weeks

TARS Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human TARS (NP_689508.3).
Modifications Unmodified