Antibodies

Jump to Filters
View as table Download
Myelin Basic Protein (MBP) Rabbit Polyclonal Antibody
TA336053

USD 375.00

5 Days

Rabbit Polyclonal Anti-MBP Antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV