GSTT1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GSTT1 |
GSTT1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GSTT1 |
Rabbit Polyclonal antibody to GSTM1 (glutathione S-transferase mu 1)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 189 of GSTM1 |
Rabbit Polyclonal Anti-CYP2E1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit polyclonal anti-ALDH3B1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ALDH3B1. |
Rabbit polyclonal anti-AOX1 antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AOX1. |
Rabbit polyclonal Cytochrome P450 2D6 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2D6. |
Rabbit polyclonal Cytochrome P450 2B6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2B6. |
Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 2B6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Cytochrome P450 2B6. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-GSTT1/4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GSTT1/4. |
Rabbit polyclonal Cytochrome P450 2A6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 2A6. |
Rabbit polyclonal anti-CYP2A7 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CYP2A7. |
Rabbit polyclonal Cytochrome P450 2A13 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2A13. |
Rabbit polyclonal Cytochrome P450 2C8/9/18/19 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8/9/18/19. |
Rabbit polyclonal Cytochrome P450 2D6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2D6. |
Rabbit polyclonal anti-CYP2D6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CYP2D6. |
Rabbit polyclonal anti-CYP2D6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CYP2D6. |
USD 345.00
In Stock
Rabbit polyclonal anti-MGST1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MGST1. |
Rabbit polyclonal anti-MGST2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human MGST2. |
Anti-ALDH3A1 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1 |
Anti-ALDH3A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1 |
Anti-AOX1 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde oxidase 1 |
Anti-ALDH3B1 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member B1 |
Anti-ALDH3B1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member B1 |
Anti-ADH1B Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 226-338 amino acids of human alcohol dehydrogenase 1B (class I), beta polypeptide |
Anti-CYP3A4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4 |
Anti-CYP3A4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4 |
Rabbit Polyclonal Anti-CYP2E1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP2E1 |
Rabbit Polyclonal Anti-GSTO1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GSTO1 |
Rabbit Polyclonal Anti-GSTA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GSTA3 |
Rabbit Polyclonal Anti-GSTP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GSTP1 |
Rabbit Polyclonal Anti-UGT1A10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UGT1A10 |
Rabbit Polyclonal Anti-CYP2D6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYP2D6 |
Rabbit Polyclonal Anti-CYP1A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYP1A2 |
Rabbit polyclonal anti-AOX1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AOX1 |