Rabbit polyclonal BLNK (Tyr84) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BLNK around the phosphorylation site of tyrosine 84 (E-M-YP-V-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal BLNK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BLNK |
Rabbit Polyclonal BLNK (Tyr96) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BLNK around the phosphorylation site of Tyrosine 96 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against BLNK
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KDSTRLKYAVKVS, from the C Terminus of the protein sequence according to NP_037446.1. |
Rabbit Polyclonal Anti-BLNK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLNK antibody: synthetic peptide directed towards the middle region of human BLNK. Synthetic peptide located within the following region: QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV |
BLNK rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BLNK |
Germany
Japan
United Kingdom
China
