Antibodies

View as table Download

Goat Polyclonal Antibody against MPP6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QQVLENLTELPSS-C, from the N Terminus of the protein sequence according to NP_057531.2.

Rabbit Polyclonal Anti-MPP6 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mpp6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mpp6. Synthetic peptide located within the following region: TTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGT

Carrier-free (BSA/glycerol-free) MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-MPP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MPP6

MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated