Goat Polyclonal Antibody against MPP6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QQVLENLTELPSS-C, from the N Terminus of the protein sequence according to NP_057531.2. |
Goat Polyclonal Antibody against MPP6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QQVLENLTELPSS-C, from the N Terminus of the protein sequence according to NP_057531.2. |
Rabbit Polyclonal Anti-MPP6 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Mpp6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mpp6. Synthetic peptide located within the following region: TTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGT |
Carrier-free (BSA/glycerol-free) MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MPP6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MPP6 |
MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MPP6 mouse monoclonal antibody, clone OTI3H5 (formerly 3H5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |