Antibodies

View as table Download

ATF4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ATF4

Goat Polyclonal Antibody against ATF4

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEVRKARGKKRVP, from the C Terminus of the protein sequence according to NP_001666.

Rabbit polyclonal ATF-4 (Ab-219) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ATF4.

Rabbit polyclonal ATF4 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 171-198 amino acids from the Central region of human ATF4.

Rabbit Polyclonal Anti-ATF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the middle region of human ATF4. Synthetic peptide located within the following region: LGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGS

Rabbit Polyclonal Anti-ATF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the C terminal of human ATF4. Synthetic peptide located within the following region: EQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLK