Antibodies

View as table Download

Rabbit Polyclonal Anti-SNAI1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SNAI1

Rabbit polyclonal SNAI1 (Ser246) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human: Ser246, Mouse: Ser246
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M).
Modifications Phospho-specific

Rabbit anti-Snail Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Snail

Rabbit Polyclonal SNAI1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SNAI1

Rabbit polyclonal anti-SNAI1 (Ab-246) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M)

Rabbit Polyclonal SNAI1 (Ser246) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SNAI1 around the phosphorylation site of Serine 246
Modifications Phospho-specific

Rabbit Polyclonal Anti-SNAI1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SNAI1 Antibody: synthetic peptide directed towards the N terminal of human SNAI1. Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL