Antibodies

Jump to Filters
View as table Download
Heparin Cofactor II (SERPIND1) Rabbit Polyclonal Antibody
TA332957

USD 275.00

3 Weeks

Rabbit anti-SERPIND1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPIND1
Heparin Cofactor II (SERPIND1) Rabbit Polyclonal Antibody
TA346026

USD 475.00

5 Days

Rabbit Polyclonal Anti-SERPIND1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPIND1 antibody: synthetic peptide directed towards the middle region of human SERPIND1. Synthetic peptide located within the following region: VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ