Germany
Japan
United Kingdom
China
Antibodies
View as table Download
BLVRB Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | C Terminus (TTDEYDGHSTYP) |
BLVRB Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region (SRLPSEGPRPAH) |
Rabbit polyclonal Anti-BLVRB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLVRB antibody: synthetic peptide directed towards the middle region of human BLVRB. Synthetic peptide located within the following region: GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD |
BLVRB Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-206 of human BLVRB (NP_000704.1). |
| Modifications | Unmodified |