Antibodies

View as table Download

Rabbit Polyclonal Anti-CDADC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDADC1 Antibody is: synthetic peptide directed towards the C-terminal region of Human CDADC1. Synthetic peptide located within the following region: EGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGI

CDADC1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein