Rabbit Polyclonal Anti-DAND5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DAND5 antibody is: synthetic peptide directed towards the N-terminal region of Human DAND5. Synthetic peptide located within the following region: SGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAF |
Rabbit Polyclonal Anti-DAND5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DAND5 Antibody is: synthetic peptide directed towards the C-terminal region of Human DAND5. Synthetic peptide located within the following region: YIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEG |
DAND5 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
USD 420.00
4 Weeks
DAND5 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
DAND5 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
