Antibodies

Jump to Filters
View as table Download
KRT73 (C-term) Rabbit Polyclonal Antibody
AP52420PU-N

USD 450.00

2 Weeks

KRT73 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 500-530 amino acids from the C-terminal region of human KRT73
KRT73 Rabbit Polyclonal Antibody
TA331581

USD 375.00

5 Days

Rabbit Polyclonal Anti-KRT73 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KRT73 Antibody is: synthetic peptide directed towards the C-terminal region of Human KRT73. Synthetic peptide located within the following region: YSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLALSSPTKKTMR